Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP6V1C1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
More info about ATP6V1C1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000528-A01 |
| Product name: | ATP6V1C1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ATP6V1C1. |
| Gene id: | 528 |
| Gene name: | ATP6V1C1 |
| Gene alias: | ATP6C|ATP6D|FLJ20057|VATC|Vma5 |
| Gene description: | ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 |
| Genbank accession: | NM_001695 |
| Immunogen: | ATP6V1C1 (NP_001686, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMA |
| Protein accession: | NP_001686 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ATP6V1C1 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of ATP6V1C1 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |