Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP6V1A monoclonal antibody (M02), clone 4F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ATP6V1A monoclonal antibody (M02), clone 4F5
| Brand: | Abnova |
| Reference: | H00000523-M02 |
| Product name: | ATP6V1A monoclonal antibody (M02), clone 4F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V1A. |
| Clone: | 4F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 523 |
| Gene name: | ATP6V1A |
| Gene alias: | ATP6A1|ATP6V1A1|HO68|VA68|VPP2|Vma1 |
| Gene description: | ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A |
| Genbank accession: | NM_001690 |
| Immunogen: | ATP6V1A (NP_001681, 508 a.a. ~ 617 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED |
| Protein accession: | NP_001681 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Extracellular and Luminal pH Regulation by Vacuolar H+-ATPase Isoform Expression and Targeting to the Plasma Membrane and Endosomes.Smith GA, Howell GJ, Phillips C, Muench SP, Ponnambalam S, Harrison MA. J Biol Chem. 2016 Feb 24. |