Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP6V1A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ATP6V1A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000523-A01 |
| Product name: | ATP6V1A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ATP6V1A. |
| Gene id: | 523 |
| Gene name: | ATP6V1A |
| Gene alias: | ATP6A1|ATP6V1A1|HO68|VA68|VPP2|Vma1 |
| Gene description: | ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A |
| Genbank accession: | NM_001690 |
| Immunogen: | ATP6V1A (NP_001681, 508 a.a. ~ 617 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED |
| Protein accession: | NP_001681 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ATP6V1A polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of ATP6V1A expression in Daoy. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | mTORC1 and muscle regeneration are regulated by the LINC00961-encoded SPAR polypeptide.Matsumoto A, Pasut A, Matsumoto M, Yamashita R, Fung J, Monteleone E, Saghatelian A, Nakayama KI, Clohessy JG, Pandolfi PP. Nature. 2017 Jan 12;541(7636):228-232. Epub 2016 Dec 26. |