| Brand: | Abnova |
| Reference: | H00000516-M01 |
| Product name: | ATP5G1 monoclonal antibody (M01), clone 1A12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ATP5G1. |
| Clone: | 1A12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 516 |
| Gene name: | ATP5G1 |
| Gene alias: | ATP5A|ATP5G |
| Gene description: | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) |
| Genbank accession: | BC004963 |
| Immunogen: | ATP5G1 (AAH04963, 18 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM |
| Protein accession: | AAH04963 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged ATP5G1 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Neuronal cell surface ATP synthase mediates synthesis of extracellular ATP and regulation of intracellular pH.Xing SL, Yan J, Yu ZH, Zhu CQ. Cell Biol Int. 2010 Jul 14. [Epub ahead of print] |