Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP2A3 monoclonal antibody (M01), clone 2H3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about ATP2A3 monoclonal antibody (M01), clone 2H3
| Brand: | Abnova |
| Reference: | H00000489-M01 |
| Product name: | ATP2A3 monoclonal antibody (M01), clone 2H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP2A3. |
| Clone: | 2H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 489 |
| Gene name: | ATP2A3 |
| Gene alias: | SERCA3 |
| Gene description: | ATPase, Ca++ transporting, ubiquitous |
| Genbank accession: | BC035729 |
| Immunogen: | ATP2A3 (AAH35729, 501 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR |
| Protein accession: | AAH35729 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.94 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ATP2A3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Loss of endoplasmic reticulum calcium pump expression in choroid plexus tumours.Ait-Ghezali L, Arbabian A, Jeibmann A, Hasselblatt M, Hallaert GG, Van den Broecke C, Gray F, Brouland JP, Varin-Blank N, Papp B Neuropathol Appl Neurobiol. 2014 Oct;40(6):726-35. doi: 10.1111/nan.12098. |