| Brand: | Abnova |
| Reference: | H00000486-M01 |
| Product name: | FXYD2 monoclonal antibody (M01), clone 1C3-B3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FXYD2. |
| Clone: | 1C3-B3 |
| Isotype: | IgG2b kappa |
| Gene id: | 486 |
| Gene name: | FXYD2 |
| Gene alias: | ATP1G1|HOMG2|MGC12372 |
| Gene description: | FXYD domain containing ion transport regulator 2 |
| Genbank accession: | BC005302 |
| Immunogen: | FXYD2 (AAH05302.1, 1 a.a. ~ 64 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
| Protein accession: | AAH05302.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A genomic-based approach identifies FXYD domain containing ion transport regulator 2 (FXYD2)gammaa as a pancreatic beta cell-specific biomarker.Flamez D, Roland I, Berton A, Kutlu B, Dufrane D, Beckers MC, De Waele E, Rooman I, Bouwens L, Clark A, Lonneux M, Jamar JF, Goldman S, Marechal D, Goodman N, Gianello P, Van Huffel C, Salmon I, Eizirik DL. Diabetologia. 2010 Apr 9. [Epub ahead of print] |