ATP1B3 monoclonal antibody (M06), clone 2F5 View larger

ATP1B3 monoclonal antibody (M06), clone 2F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP1B3 monoclonal antibody (M06), clone 2F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ATP1B3 monoclonal antibody (M06), clone 2F5

Brand: Abnova
Reference: H00000483-M06
Product name: ATP1B3 monoclonal antibody (M06), clone 2F5
Product description: Mouse monoclonal antibody raised against a full length recombinant ATP1B3.
Clone: 2F5
Isotype: IgG2a Kappa
Gene id: 483
Gene name: ATP1B3
Gene alias: ATPB-3|CD298|FLJ29027
Gene description: ATPase, Na+/K+ transporting, beta 3 polypeptide
Genbank accession: BC011835
Immunogen: ATP1B3 (AAH11835, 1 a.a. ~ 279 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Protein accession: AAH11835
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000483-M06-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ATP1B3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: The importance of adequate fixation for immunofluorescent staining of bovine embryos.Goossens K, Vandaele L, Wydooghe E, Thys M, Dewulf J, Peelman Lj, Van Soom A.
Reprod Domest Anim. 2011 Dec;46(6):1098-103. doi: 10.1111/j.1439-0531.2011.01770.x. Epub 2011 Mar 3.

Reviews

Buy ATP1B3 monoclonal antibody (M06), clone 2F5 now

Add to cart