Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP1B3 monoclonal antibody (M05), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ATP1B3 monoclonal antibody (M05), clone 2F4
| Brand: | Abnova |
| Reference: | H00000483-M05 |
| Product name: | ATP1B3 monoclonal antibody (M05), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ATP1B3. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 483 |
| Gene name: | ATP1B3 |
| Gene alias: | ATPB-3|CD298|FLJ29027 |
| Gene description: | ATPase, Na+/K+ transporting, beta 3 polypeptide |
| Genbank accession: | BC011835 |
| Immunogen: | ATP1B3 (AAH11835, 1 a.a. ~ 279 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA |
| Protein accession: | AAH11835 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ATP1B3 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | The importance of adequate fixation for immunofluorescent staining of bovine embryos.Goossens K, Vandaele L, Wydooghe E, Thys M, Dewulf J, Peelman Lj, Van Soom A. Reprod Domest Anim. 2011 Dec;46(6):1098-103. doi: 10.1111/j.1439-0531.2011.01770.x. Epub 2011 Mar 3. |