| Brand: | Abnova |
| Reference: | H00000467-M04 |
| Product name: | ATF3 monoclonal antibody (M04), clone 8G5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ATF3. |
| Clone: | 8G5 |
| Isotype: | IgG3 Kappa |
| Gene id: | 467 |
| Gene name: | ATF3 |
| Gene alias: | - |
| Gene description: | activating transcription factor 3 |
| Genbank accession: | BC006322 |
| Immunogen: | ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS |
| Protein accession: | AAH06322 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ATF3 monoclonal antibody (M04), clone 8G5 Western Blot analysis of ATF3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Transcriptional regulators of the ÎNp63: Their role in limbal epithelial cell proliferation.Hsueh YJ, Kuo PC, Chen JK. J Cell Physiol. 2012 Jul 17. doi: 10.1002/jcp.24160. |