Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATF1 monoclonal antibody (M01A), clone 6G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about ATF1 monoclonal antibody (M01A), clone 6G10
| Brand: | Abnova |
| Reference: | H00000466-M01A |
| Product name: | ATF1 monoclonal antibody (M01A), clone 6G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATF1. |
| Clone: | 6G10 |
| Isotype: | IgM Kappa |
| Gene id: | 466 |
| Gene name: | ATF1 |
| Gene alias: | EWS-ATF1|FUS/ATF-1|TREB36 |
| Gene description: | activating transcription factor 1 |
| Genbank accession: | NM_005171 |
| Immunogen: | ATF1 (NP_005162, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRL |
| Protein accession: | NP_005162 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |