Cart 18 Product Products 5 083,30 € (empty)
No products
To be determined Shipping
5 083,30 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 18 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 083,30 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 083,30 €
Data sheet of ZFHX3 monoclonal antibody (M01), clone 3B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about ZFHX3 monoclonal antibody (M01), clone 3B1
| Brand: | Abnova |
| Reference: | H00000463-M01 |
| Product name: | ZFHX3 monoclonal antibody (M01), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZFHX3. |
| Clone: | 3B1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 463 |
| Gene name: | ZFHX3 |
| Gene alias: | ATBF1|ATBT |
| Gene description: | zinc finger homeobox 3 |
| Genbank accession: | NM_006885 |
| Immunogen: | ZFHX3 (NP_008816, 2811 a.a. ~ 2910 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG |
| Protein accession: | NP_008816 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZFHX3 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |