No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000443-D01P |
| Product name: | ASPA purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ASPA protein. |
| Gene id: | 443 |
| Gene name: | ASPA |
| Gene alias: | ACY2|ASP |
| Gene description: | aspartoacylase (Canavan disease) |
| Genbank accession: | NM_000049.2 |
| Immunogen: | ASPA (NP_000040.1, 1 a.a. ~ 313 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH |
| Protein accession: | NP_000040.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ASPA expression in transfected 293T cell line (H00000443-T01) by ASPA MaxPab polyclonal antibody. Lane 1: ASPA transfected lysate(35.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |