No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00000443-D01 |
Product name: | ASPA MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ASPA protein. |
Gene id: | 443 |
Gene name: | ASPA |
Gene alias: | ACY2|ASP |
Gene description: | aspartoacylase (Canavan disease) |
Genbank accession: | NM_000049.2 |
Immunogen: | ASPA (NP_000040.1, 1 a.a. ~ 313 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH |
Protein accession: | NP_000040.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in human liver. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |