Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ASMT polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ASMT polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000438-A01 |
| Product name: | ASMT polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ASMT. |
| Gene id: | 438 |
| Gene name: | ASMT |
| Gene alias: | ASMTY|HIOMT|HIOMTY |
| Gene description: | acetylserotonin O-methyltransferase |
| Genbank accession: | NM_004043 |
| Immunogen: | ASMT (NP_004034, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRS |
| Protein accession: | NP_004034 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ASMT polyclonal antibody (A01), Lot # COO0060228QCS1 Western Blot analysis of ASMT expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Dynamics in enzymatic protein complexes offer a novel principle for the regulation of melatonin synthesis in the human pineal gland.Maronde E, Saade A, Ackermann K, Goubran-Botros H, Pagan C, Bux R, Bourgeron T, Dehghani F, Stehle JH. J Pineal Res. 2011 Aug;51(1):145-55. doi: 10.1111/j.1600-079X.2011.00880.x. Epub 2011 Apr 26. |