Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARVCF monoclonal antibody (M01), clone 5D2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re |
More info about ARVCF monoclonal antibody (M01), clone 5D2
| Brand: | Abnova |
| Reference: | H00000421-M01 |
| Product name: | ARVCF monoclonal antibody (M01), clone 5D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARVCF. |
| Clone: | 5D2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 421 |
| Gene name: | ARVCF |
| Gene alias: | FLJ35345 |
| Gene description: | armadillo repeat gene deletes in velocardiofacial syndrome |
| Genbank accession: | NM_001670 |
| Immunogen: | ARVCF (NP_001661, 863 a.a. ~ 962 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV |
| Protein accession: | NP_001661 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ARVCF on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Xenopus Kazrin interacts with ARVCF-catenin, spectrin and p190B RhoGAP, and modulates RhoA activity and epithelial integrity.Cho K, Vaught TG, Ji H, Gu D, Papasakelariou-Yared C, Horstmann N, Jennings JM, Lee M, Sevilla LM, Kloc M, Reynolds AB, Watt FM, Brennan RG, Kowalczyk AP, McCrea PD. J Cell Sci. 2010 Dec 1;123(Pt 23):4128-44. Epub 2010 Nov 9. |