No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00000419-M09 |
Product name: | ART3 monoclonal antibody (M09), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ART3. |
Clone: | 1D2 |
Isotype: | IgG2b Kappa |
Gene id: | 419 |
Gene name: | ART3 |
Gene alias: | FLJ26404 |
Gene description: | ADP-ribosyltransferase 3 |
Genbank accession: | NM_001179 |
Immunogen: | ART3 (NP_001170, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF |
Protein accession: | NP_001170 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ART3 expression in transfected 293T cell line by ART3 monoclonal antibody (M09), clone 1D2. Lane 1: ART3 transfected lysate(42.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |