| Brand: | Abnova |
| Reference: | H00000419-M05 |
| Product name: | ART3 monoclonal antibody (M05), clone 3A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ART3. |
| Clone: | 3A2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 419 |
| Gene name: | ART3 |
| Gene alias: | FLJ26404 |
| Gene description: | ADP-ribosyltransferase 3 |
| Genbank accession: | NM_001179 |
| Immunogen: | ART3 (NP_001170, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF |
| Protein accession: | NP_001170 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ART3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 2 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Genome-Wide Expression of Azoospermia Testes Demonstrates a Specific Profile and Implicates ART3 in Genetic Susceptibility.Okada H, Tajima A, Shichiri K, Tanaka A, Tanaka K, Inoue I. PLoS Genet. 2008 Feb;4(2):e26. |