Brand: | Abnova |
Reference: | H00000405-M01 |
Product name: | ARNT monoclonal antibody (M01), clone 3D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARNT. |
Clone: | 3D10 |
Isotype: | IgG2a Kappa |
Gene id: | 405 |
Gene name: | ARNT |
Gene alias: | HIF-1beta|HIF1B|HIF1BETA|TANGO|bHLHe2 |
Gene description: | aryl hydrocarbon receptor nuclear translocator |
Genbank accession: | BC060838 |
Immunogen: | ARNT (AAH60838, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT |
Protein accession: | AAH60838 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |