No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00000401-M01 |
Product name: | PHOX2A monoclonal antibody (M01), clone 4F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHOX2A. |
Clone: | 4F6 |
Isotype: | IgG2a Kappa |
Gene id: | 401 |
Gene name: | PHOX2A |
Gene alias: | ARIX|CFEOM2|FEOM2|MGC52227|NCAM2|PMX2A |
Gene description: | paired-like homeobox 2a |
Genbank accession: | NM_005169 |
Immunogen: | PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ |
Protein accession: | NP_005160 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |