No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00000399-M01 |
Product name: | RHOH monoclonal antibody (M01), clone 4H5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RHOH. |
Clone: | 4H5 |
Isotype: | IgG2b Kappa |
Gene id: | 399 |
Gene name: | RHOH |
Gene alias: | ARHH|TTF |
Gene description: | ras homolog gene family, member H |
Genbank accession: | BC014261 |
Immunogen: | RHOH (AAH14261.1, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVVTQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF |
Protein accession: | AAH14261.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |