| Brand: | Abnova |
| Reference: | H00000397-M01 |
| Product name: | ARHGDIB monoclonal antibody (M01), clone 2C12-B6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ARHGDIB. |
| Clone: | 2C12-B6 |
| Isotype: | IgG1 kappa |
| Gene id: | 397 |
| Gene name: | ARHGDIB |
| Gene alias: | D4|GDIA2|GDID4|LYGDI|Ly-GDI|RAP1GN1|RhoGDI2 |
| Gene description: | Rho GDP dissociation inhibitor (GDI) beta |
| Genbank accession: | BC009200 |
| Immunogen: | ARHGDIB (AAH09200, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
| Protein accession: | AAH09200 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ARHGDIB is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |