Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARHGDIA monoclonal antibody (M02), clone 1G5-2F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about ARHGDIA monoclonal antibody (M02), clone 1G5-2F3
| Brand: | Abnova |
| Reference: | H00000396-M02 |
| Product name: | ARHGDIA monoclonal antibody (M02), clone 1G5-2F3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ARHGDIA. |
| Clone: | 1G5-2F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 396 |
| Gene name: | ARHGDIA |
| Gene alias: | GDIA1|MGC117248|RHOGDI|RHOGDI-1 |
| Gene description: | Rho GDP dissociation inhibitor (GDI) alpha |
| Genbank accession: | BC016031 |
| Immunogen: | ARHGDIA (AAH16031, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
| Protein accession: | AAH16031 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ARHGDIA is approximately 0.3ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Comparative proteomic analysis on human L-02 liver cells treated with varying concentrations of trichloroethyleneLiu J, Huang H, Xing X, Xi R, Zhuang Z, Yuan J, Yang F, Zhao J. Toxicol Ind Health. 2007 Mar;23(2):91-101. |