No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000396-M02 |
Product name: | ARHGDIA monoclonal antibody (M02), clone 1G5-2F3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ARHGDIA. |
Clone: | 1G5-2F3 |
Isotype: | IgG1 Kappa |
Gene id: | 396 |
Gene name: | ARHGDIA |
Gene alias: | GDIA1|MGC117248|RHOGDI|RHOGDI-1 |
Gene description: | Rho GDP dissociation inhibitor (GDI) alpha |
Genbank accession: | BC016031 |
Immunogen: | ARHGDIA (AAH16031, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
Protein accession: | AAH16031 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (48.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged ARHGDIA is approximately 0.3ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Comparative proteomic analysis on human L-02 liver cells treated with varying concentrations of trichloroethyleneLiu J, Huang H, Xing X, Xi R, Zhuang Z, Yuan J, Yang F, Zhao J. Toxicol Ind Health. 2007 Mar;23(2):91-101. |