Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00000396-D03P |
Product name: | ARHGDIA purified MaxPab rabbit polyclonal antibody (D03P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein. |
Gene id: | 396 |
Gene name: | ARHGDIA |
Gene alias: | GDIA1|MGC117248|RHOGDI|RHOGDI-1 |
Gene description: | Rho GDP dissociation inhibitor (GDI) alpha |
Genbank accession: | BC016031 |
Immunogen: | ARHGDIA (AAH16031.1, 1 a.a. ~ 204 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
Protein accession: | AAH16031.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of ARHGDIA expression in transfected 293T cell line (H00000396-T03) by ARHGDIA MaxPab polyclonal antibody. Lane 1: ARHGDIA transfected lysate(22.55 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |