| Brand: | Abnova |
| Reference: | H00000396-D03 |
| Product name: | ARHGDIA MaxPab rabbit polyclonal antibody (D03) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein. |
| Gene id: | 396 |
| Gene name: | ARHGDIA |
| Gene alias: | GDIA1|MGC117248|RHOGDI|RHOGDI-1 |
| Gene description: | Rho GDP dissociation inhibitor (GDI) alpha |
| Genbank accession: | BC016031 |
| Immunogen: | ARHGDIA (AAH16031.1, 1 a.a. ~ 204 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
| Protein accession: | AAH16031.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoprecipitation of ARHGDIA transfected lysate using anti-ARHGDIA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ARHGDIA MaxPab mouse polyclonal antibody (B01) (H00000396-B01). |
| Applications: | WB-Ce,WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |