No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000396-A02 |
Product name: | ARHGDIA polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant ARHGDIA. |
Gene id: | 396 |
Gene name: | ARHGDIA |
Gene alias: | GDIA1|MGC117248|RHOGDI|RHOGDI-1 |
Gene description: | Rho GDP dissociation inhibitor (GDI) alpha |
Genbank accession: | BC005851 |
Immunogen: | ARHGDIA (AAH05851, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
Protein accession: | AAH05851 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (48.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ARHGDIA polyclonal antibody (A02), Lot # 050921JC01 Western Blot analysis of ARHGDIA expression in SJCRH30 ( Cat # L027V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |