Cart 61 Product Products 21 644,49 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x HUNK...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
21 644,49 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 61 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 21 644,49 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 21 644,49 €
Data sheet of ARHGAP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ARHGAP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000392-A01 |
| Product name: | ARHGAP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ARHGAP1. |
| Gene id: | 392 |
| Gene name: | ARHGAP1 |
| Gene alias: | CDC42GAP|RHOGAP|RHOGAP1|p50rhoGAP |
| Gene description: | Rho GTPase activating protein 1 |
| Genbank accession: | BC018118 |
| Immunogen: | ARHGAP1 (AAH18118, 340 a.a. ~ 439 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL |
| Protein accession: | AAH18118 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ARHGAP1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of ARHGAP1 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Cdo-Bnip-2-Cdc42 signaling pathway regulates p38alpha/beta MAPK activity and myogenic differentiation.Kang JS, Bae GU, Yi MJ, Yang YJ, Oh JE, Takaesu G, Zhou YT, Low BC, Krauss RS. J Cell Biol. 2008 Aug 11;182(3):497-507. Epub 2008 Aug 4. |