Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RHOC monoclonal antibody (M06), clone 1B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about RHOC monoclonal antibody (M06), clone 1B7
| Brand: | Abnova |
| Reference: | H00000389-M06 |
| Product name: | RHOC monoclonal antibody (M06), clone 1B7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant RHOC. |
| Clone: | 1B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 389 |
| Gene name: | RHOC |
| Gene alias: | ARH9|ARHC|H9|MGC1448|MGC61427|RHOH9 |
| Gene description: | ras homolog gene family, member C |
| Genbank accession: | BC007245 |
| Immunogen: | RHOC (AAH07245, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL |
| Protein accession: | AAH07245 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.97 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Rhos and Rho kinases in the rat prostate: their possible functional roles and distributions.Saito M, Ohmasa F, Shomori K, Dimitriadis F, Ohiwa H, Shimizu S, Tsounapi P, Kinoshita Y, Satoh K. Mol Cell Biochem. 2011 Jul 1. [Epub ahead of print] |