| Brand: | Abnova |
| Reference: | H00000387-M02 |
| Product name: | RHOA monoclonal antibody (M02), clone 1G7-1D11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RHOA. |
| Clone: | 1G7-1D11 |
| Isotype: | IgG1 lambda |
| Gene id: | 387 |
| Gene name: | RHOA |
| Gene alias: | ARH12|ARHA|RHO12|RHOH12 |
| Gene description: | ras homolog gene family, member A |
| Genbank accession: | BC001360 |
| Immunogen: | RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
| Protein accession: | AAH01360 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.97 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RHOA is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |