No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA |
Brand: | Abnova |
Reference: | H00000375-M02 |
Product name: | ARF1 monoclonal antibody (M02), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ARF1. |
Clone: | 4G6 |
Isotype: | IgG2a Kappa |
Gene id: | 375 |
Gene name: | ARF1 |
Gene alias: | - |
Gene description: | ADP-ribosylation factor 1 |
Genbank accession: | BC011358 |
Immunogen: | ARF1 (AAH11358.1, 1 a.a. ~ 181 a.a) full-length recombinant protein. |
Immunogen sequence/protein sequence: | MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDVVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Protein accession: | AAH11358.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to ARF1 on HeLa cell . [antibody concentration 20 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |