| Brand: | Abnova |
| Reference: | H00000375-M02 |
| Product name: | ARF1 monoclonal antibody (M02), clone 4G6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ARF1. |
| Clone: | 4G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 375 |
| Gene name: | ARF1 |
| Gene alias: | - |
| Gene description: | ADP-ribosylation factor 1 |
| Genbank accession: | BC011358 |
| Immunogen: | ARF1 (AAH11358.1, 1 a.a. ~ 181 a.a) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDVVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
| Protein accession: | AAH11358.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to ARF1 on HeLa cell . [antibody concentration 20 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |