| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00000374-D01P |
| Product name: | AREG purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human AREG protein. |
| Gene id: | 374 |
| Gene name: | AREG |
| Gene alias: | AR|CRDGF|MGC13647|SDGF |
| Gene description: | amphiregulin |
| Genbank accession: | NM_001657.2 |
| Immunogen: | AREG (NP_001648.1, 1 a.a. ~ 252 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA |
| Protein accession: | NP_001648.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of AREG expression in transfected 293T cell line (H00000374-T03) by AREG MaxPab polyclonal antibody. Lane 1: AREG transfected lysate(27.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |