| Brand: | Abnova |
| Reference: | H00000369-M05 |
| Product name: | ARAF monoclonal antibody (M05), clone 3E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARAF. |
| Clone: | 3E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 369 |
| Gene name: | ARAF |
| Gene alias: | A-RAF|ARAF1|PKS2|RAFA1 |
| Gene description: | v-raf murine sarcoma 3611 viral oncogene homolog |
| Genbank accession: | NM_001654 |
| Immunogen: | ARAF (NP_001645, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS |
| Protein accession: | NP_001645 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ARAF monoclonal antibody (M05), clone 3E2 Western Blot analysis of ARAF expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |