No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000369-M04 |
Product name: | ARAF monoclonal antibody (M04), clone 3G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARAF. |
Clone: | 3G2 |
Isotype: | IgG2a Kappa |
Gene id: | 369 |
Gene name: | ARAF |
Gene alias: | A-RAF|ARAF1|PKS2|RAFA1 |
Gene description: | v-raf murine sarcoma 3611 viral oncogene homolog |
Genbank accession: | NM_001654 |
Immunogen: | ARAF (NP_001645, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS |
Protein accession: | NP_001645 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ARAF monoclonal antibody (M04), clone 3G2 Western Blot analysis of ARAF expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |