| Brand: | Abnova |
| Reference: | H00000368-M01 |
| Product name: | ABCC6 monoclonal antibody (M01), clone 1E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCC6. |
| Clone: | 1E6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 368 |
| Gene name: | ABCC6 |
| Gene alias: | ABC34|ARA|EST349056|MLP1|MOATE|MRP6|PXE|PXE1 |
| Gene description: | ATP-binding cassette, sub-family C (CFTR/MRP), member 6 |
| Genbank accession: | NM_001171 |
| Immunogen: | ABCC6 (NP_001162, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV |
| Protein accession: | NP_001162 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ABCC6 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |