| Brand: | Abnova |
| Reference: | H00000367-M01 |
| Product name: | AR monoclonal antibody (M01), clone 1G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AR. |
| Clone: | 1G3 |
| Isotype: | IgG1 kappa |
| Gene id: | 367 |
| Gene name: | AR |
| Gene alias: | AIS|DHTR|HUMARA|KD|NR3C4|SBMA|SMAX1|TFM |
| Gene description: | androgen receptor |
| Genbank accession: | NM_000044 |
| Immunogen: | AR (NP_000035, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL |
| Protein accession: | NP_000035 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to AR on formalin-fixed paraffin-embedded human renal cell carcinoma tissue. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |