| Brand: | Abnova |
| Reference: | H00000356-M02 |
| Product name: | FASLG monoclonal antibody (M02), clone 2G9-G8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FASLG. |
| Clone: | 2G9-G8 |
| Isotype: | IgG2a kappa |
| Gene id: | 356 |
| Gene name: | FASLG |
| Gene alias: | APT1LG1|CD178|CD95L|FASL|TNFSF6 |
| Gene description: | Fas ligand (TNF superfamily, member 6) |
| Genbank accession: | BC017502 |
| Immunogen: | FASLG (AAH17502.1, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Protein accession: | AAH17502.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to TNFSF6 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |