Brand: | Abnova |
Reference: | H00000355-M07 |
Product name: | FAS monoclonal antibody (M07), clone 7F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FAS. |
Clone: | 7F12 |
Isotype: | IgG1 Kappa |
Gene id: | 355 |
Gene name: | FAS |
Gene alias: | ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6 |
Gene description: | Fas (TNF receptor superfamily, member 6) |
Genbank accession: | NM_000043 |
Immunogen: | FAS (NP_000034, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC |
Protein accession: | NP_000034 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FAS is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |