| Brand: | Abnova |
| Reference: | H00000354-M02 |
| Product name: | KLK3 monoclonal antibody (M02), clone 1B1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant KLK3. |
| Clone: | 1B1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 354 |
| Gene name: | KLK3 |
| Gene alias: | APS|KLK2A1|PSA|hK3 |
| Gene description: | kallikrein-related peptidase 3 |
| Genbank accession: | BC005307 |
| Immunogen: | KLK3 (AAH05307, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDVSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKLMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP |
| Protein accession: | AAH05307 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to KLK3 on A-549 cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |