| Brand: | Abnova |
| Reference: | H00000350-M04A |
| Product name: | APOH monoclonal antibody (M04A), clone 2F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant APOH. |
| Clone: | 2F12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 350 |
| Gene name: | APOH |
| Gene alias: | B2G1|BG |
| Gene description: | apolipoprotein H (beta-2-glycoprotein I) |
| Genbank accession: | NM_000042 |
| Immunogen: | APOH (NP_000033, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC |
| Protein accession: | NP_000033 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |