APOC3 (Human) Recombinant Protein (Q01) View larger

APOC3 (Human) Recombinant Protein (Q01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOC3 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about APOC3 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00000345-Q01
Product name: APOC3 (Human) Recombinant Protein (Q01)
Product description: Human APOC3 partial ORF ( NP_000031.1, 21 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 345
Gene name: APOC3
Gene alias: APOCIII|MGC150353
Gene description: apolipoprotein C-III
Genbank accession: NM_000040
Immunogen sequence/protein sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Protein accession: NP_000031.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000345-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Apolipoprotein A-IV is a candidate target molecule for the treatment of seasonal allergic rhinitis.Makino Y, Noguchi E, Takahashi N, Matsumoto Y, Kubo S, Yamada T, Imoto Y, Ito Y, Osawa Y, Shibasaki M, Uchida K, Meno K, Suzuki H, Okubo K, Arinami T, Fujieda S.
J Allergy Clin Immunol. 2010 Aug 30. [Epub ahead of print]

Reviews

Buy APOC3 (Human) Recombinant Protein (Q01) now

Add to cart