Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of APOC1 monoclonal antibody (M01), clone 2E2-1A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about APOC1 monoclonal antibody (M01), clone 2E2-1A3
| Brand: | Abnova |
| Reference: | H00000341-M01 |
| Product name: | APOC1 monoclonal antibody (M01), clone 2E2-1A3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant APOC1. |
| Clone: | 2E2-1A3 |
| Isotype: | IgG1 kappa |
| Gene id: | 341 |
| Gene name: | APOC1 |
| Gene alias: | - |
| Gene description: | apolipoprotein C-I |
| Genbank accession: | BC009698 |
| Immunogen: | APOC1 (AAH09698, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
| Protein accession: | AAH09698 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | APOC1 monoclonal antibody (M01), clone 2E2-1A3. Western Blot analysis of APOC1 expression in human liver. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Amphipathic α-Helices in Apolipoproteins Are Crucial to the Formation of Infectious Hepatitis C Virus Particles.Fukuhara T, Wada M, Nakamura S, Ono C, Shiokawa M, Yamamoto S, Motomura T, Okamoto T, Okuzaki D, Yamamoto M, Saito I, Wakita T, Koike K, Matsuura Y PLoS Pathog. 2014 Dec 11;10(12):e1004534. doi: 10.1371/journal.ppat.1004534. eCollection 2014 Dec. |