| Brand: | Abnova |
| Reference: | H00000336-M03 |
| Product name: | APOA2 monoclonal antibody (M03), clone 1H6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant APOA2. |
| Clone: | 1H6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 336 |
| Gene name: | APOA2 |
| Gene alias: | - |
| Gene description: | apolipoprotein A-II |
| Genbank accession: | BC005282 |
| Immunogen: | APOA2 (AAH05282, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
| Protein accession: | AAH05282 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged APOA2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |