Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of APEX1 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IF,WB-Tr |
More info about APEX1 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand: | Abnova |
| Reference: | H00000328-D02P |
| Product name: | APEX1 purified MaxPab rabbit polyclonal antibody (D02P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human APEX1 protein. |
| Gene id: | 328 |
| Gene name: | APEX1 |
| Gene alias: | APE|APE-1|APE1|APEN|APEX|APX|HAP1|REF-1|REF1 |
| Gene description: | APEX nuclease (multifunctional DNA repair enzyme) 1 |
| Genbank accession: | NM_001641.1 |
| Immunogen: | APEX1 (NP_001632.1, 1 a.a. ~ 318 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
| Protein accession: | NP_001632.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | APEX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APEX1 expression in K-562. |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |