View larger

NUDT2 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of NUDT2 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00000318-A01
Product name:	NUDT2 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a full-length recombinant NUDT2.
Gene id:	318
Gene name:	NUDT2
Gene alias:	APAH1\|MGC10404
Gene description:	nudix (nucleoside diphosphate linked moiety X)-type motif 2
Genbank accession:	BC004926
Immunogen:	NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Protein accession:	AAH04926
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (42.28 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice