No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00000308-M01 |
| Product name: | ANXA5 monoclonal antibody (M01), clone 1F4-1A5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ANXA5. |
| Clone: | 1F4-1A5 |
| Isotype: | IgG1 kappa |
| Gene id: | 308 |
| Gene name: | ANXA5 |
| Gene alias: | ANX5|ENX2|PP4 |
| Gene description: | annexin A5 |
| Genbank accession: | BC001429 |
| Immunogen: | ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
| Protein accession: | AAH01429 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (60.94 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells.Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY. J Proteomics. 2011 Nov 7. |