| Brand: | Abnova |
| Reference: | H00000307-M13 |
| Product name: | ANXA4 monoclonal antibody (M13), clone 1D3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ANXA4. |
| Clone: | 1D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 307 |
| Gene name: | ANXA4 |
| Gene alias: | ANX4|DKFZp686H02120|MGC75105|PIG28|ZAP36 |
| Gene description: | annexin A4 |
| Genbank accession: | BC000182 |
| Immunogen: | ANXA4 (AAH00182, 1 a.a. ~ 321 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD |
| Protein accession: | AAH00182 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (61.05 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged ANXA4 is approximately 30ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Proteomic analysis of the sheep caruncular and intercaruncular endometrium reveals changes.Al-Gubory KH, Arianmanesh M, Garrel C, Bhattacharya S, Cash P, Fowler PA Reproduction. 2014 Jan 20. |