No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000307-B01P |
| Product name: | ANXA4 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ANXA4 protein. |
| Gene id: | 307 |
| Gene name: | ANXA4 |
| Gene alias: | ANX4|DKFZp686H02120|MGC75105|PIG28|ZAP36 |
| Gene description: | annexin A4 |
| Genbank accession: | NM_001153.2 |
| Immunogen: | ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD |
| Protein accession: | NP_001144.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ANXA4 expression in transfected 293T cell line (H00000307-T01) by ANXA4 MaxPab polyclonal antibody. Lane 1: ANXA4 transfected lysate(35.31 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Differences in atrial fibrillation-associated proteins between the left and right atrial appendages from patients with rheumatic mitral valve disease: A comparative proteomic analysis.patients with rheumatic mitral valve disease: A comparative proteomic analysis.Liu H, Chen G, Zheng H, Qin H, Liang M, Feng K, Wu Z. Mol Med Rep. 2016 Nov;14(5):4232-4242. Epub 2016 Sep 26. |