Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC25A4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about SLC25A4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000291-A01 |
| Product name: | SLC25A4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant SLC25A4. |
| Gene id: | 291 |
| Gene name: | SLC25A4 |
| Gene alias: | AAC1|ANT|ANT1|PEO2|PEO3|T1 |
| Gene description: | solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 |
| Genbank accession: | BC008664.1 |
| Immunogen: | SLC25A4 (AAH08664.1, 1 a.a. ~ 298 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLRVQHASRQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV |
| Protein accession: | AAH08664.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | The Interaction between Cell Adhesion Molecule L1, Matrix Metalloproteinase 14, and Adenine Nucleotide Translocator at the Plasma Membrane Regulates L1-Mediated Neurite Outgrowth of Murine Cerebellar Neurons.Loers G, Makhina T, Bork U, Dorner A, Schachner M, Kleene R. J Neurosci. 2012 Mar 14;32(11):3917-30. |