Cart 111 Product Products 36 143,75 € (empty)
No products
To be determined Shipping
36 143,75 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 111 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 36 143,75 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 36 143,75 €
Data sheet of ANPEP monoclonal antibody (M05), clone 1G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ANPEP monoclonal antibody (M05), clone 1G1
| Brand: | Abnova |
| Reference: | H00000290-M05 |
| Product name: | ANPEP monoclonal antibody (M05), clone 1G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ANPEP. |
| Clone: | 1G1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 290 |
| Gene name: | ANPEP |
| Gene alias: | APN|CD13|LAP1|PEPN|gp150|p150 |
| Gene description: | alanyl (membrane) aminopeptidase |
| Genbank accession: | BC058928 |
| Immunogen: | ANPEP (AAH58928.1, 858 a.a. ~ 967 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK |
| Protein accession: | AAH58928.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ANPEP is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |