AMELX monoclonal antibody (M03A), clone 3B5 View larger

AMELX monoclonal antibody (M03A), clone 3B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMELX monoclonal antibody (M03A), clone 3B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about AMELX monoclonal antibody (M03A), clone 3B5

Brand: Abnova
Reference: H00000265-M03A
Product name: AMELX monoclonal antibody (M03A), clone 3B5
Product description: Mouse monoclonal antibody raised against a partial recombinant AMELX.
Clone: 3B5
Isotype: IgG2b Kappa
Gene id: 265
Gene name: AMELX
Gene alias: AIH1|ALGN|AMG|AMGL|AMGX
Gene description: amelogenin (amelogenesis imperfecta 1, X-linked)
Genbank accession: NM_001142
Immunogen: AMELX (NP_001133, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Protein accession: NP_001133
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000265-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000265-M03A-1-4-1.jpg
Application image note: AMELX monoclonal antibody (M03A), clone 3B5 Western Blot analysis of AMELX expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AMELX monoclonal antibody (M03A), clone 3B5 now

Add to cart