Brand: | Abnova |
Reference: | H00000265-M03A |
Product name: | AMELX monoclonal antibody (M03A), clone 3B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AMELX. |
Clone: | 3B5 |
Isotype: | IgG2b Kappa |
Gene id: | 265 |
Gene name: | AMELX |
Gene alias: | AIH1|ALGN|AMG|AMGL|AMGX |
Gene description: | amelogenin (amelogenesis imperfecta 1, X-linked) |
Genbank accession: | NM_001142 |
Immunogen: | AMELX (NP_001133, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
Protein accession: | NP_001133 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AMELX monoclonal antibody (M03A), clone 3B5 Western Blot analysis of AMELX expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |