| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000265-M02A |
| Product name: | AMELX monoclonal antibody (M02A), clone 5B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AMELX. |
| Clone: | 5B2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 265 |
| Gene name: | AMELX |
| Gene alias: | AIH1|ALGN|AMG|AMGL|AMGX |
| Gene description: | amelogenin (amelogenesis imperfecta 1, X-linked) |
| Genbank accession: | NM_001142 |
| Immunogen: | AMELX (NP_001133, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
| Protein accession: | NP_001133 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of AMELX expression in transfected 293T cell line by AMELX monoclonal antibody (M02A), clone 5B2. Lane 1: AMELX transfected lysate (Predicted MW: 21.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |